BNP-32 (porcine) trifluoroacetate salt
H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH trifluoroacetate salt (Disulfide bond)
Product description
BNP-32 (porcine) trifluoroacetate salt,CAS :117345-87-6 from ruixi.It can be used Regenerative Medicine.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 117345-87-6 |
Sequence | SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY |
Synonyms | BNP (1-32), porcine, Brain Natriuretic Peptide-32 (porcine) |
Molecular Formula | C₁₄₉H₂₅₀N₅₂O₄₄S₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product